ACCN3 antibody (70R-1519)

Rabbit polyclonal ACCN3 antibody raised against the N terminal of ACCN3

Synonyms Polyclonal ACCN3 antibody, Anti-ACCN3 antibody, ACCN3, Amiloride-Sensitive Cation Channel 3 antibody, ACCN 3, ACCN-3, ASIC3 antibody, ACCN-3 antibody, ACCN 3 antibody
Specificity ACCN3 antibody was raised against the N terminal of ACCN3
Cross Reactivity Human
Applications IHC, WB
Immunogen ACCN3 antibody was raised using the N terminal of ACCN3 corresponding to a region with amino acids VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRL
Assay Information ACCN3 Blocking Peptide, catalog no. 33R-9439, is also available for use as a blocking control in assays to test for specificity of this ACCN3 antibody


Immunohistochemical staining using ACCN3 antibody (70R-1519)

ACCN3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ACCN3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACCN3 encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, two hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using ACCN3 antibody (70R-1519) | ACCN3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using ACCN3 antibody (70R-1519) | ACCN3 antibody (70R-1519) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors