ACCN5 antibody (70R-1510)

Rabbit polyclonal ACCN5 antibody raised against the middle region of ACCN5

Synonyms Polyclonal ACCN5 antibody, Anti-ACCN5 antibody, ACCN-5, ACCN 5, ACCN5, ACCN 5 antibody, ASIC5 antibody, ACCN-5 antibody, Amiloride-Sensitive Cation Channel 5 Intestinal antibody
Specificity ACCN5 antibody was raised against the middle region of ACCN5
Cross Reactivity Human
Applications WB
Immunogen ACCN5 antibody was raised using the middle region of ACCN5 corresponding to a region with amino acids FTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVD
Assay Information ACCN5 Blocking Peptide, catalog no. 33R-3090, is also available for use as a blocking control in assays to test for specificity of this ACCN5 antibody


Western Blot analysis using ACCN5 antibody (70R-1510)

ACCN5 antibody (70R-1510) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ACCN5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACCN5 belongs to the amiloride-sensitive Na+ channel and degenerin (NaC/DEG) family, members of which have been identified in many animal species ranging from the nematode to human. The amiloride-sensitive Na(+) channel encoded by this gene is primarily expressed in the small intestine, however, its exact function is not known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ACCN5 antibody (70R-1510) | ACCN5 antibody (70R-1510) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $315.00
Size: 100 ug
View Our Distributors