ACDC antibody (70R-1712)

Rabbit polyclonal ACDC antibody raised against the N terminal Of Acdc

Synonyms Polyclonal ACDC antibody, Anti-ACDC antibody, Adipocyte C1q and Collagen Domain Containing Protein antibody
Specificity ACDC antibody was raised against the N terminal Of Acdc
Cross Reactivity Human
Applications IHC, WB
Immunogen ACDC antibody was raised using the N terminal Of Acdc corresponding to a region with amino acids KGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIP
Assay Information ACDC Blocking Peptide, catalog no. 33R-4384, is also available for use as a blocking control in assays to test for specificity of this ACDC antibody

Images

Western Blot analysis using ACDC antibody (70R-1712)

ACDC antibody (70R-1712) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ACDC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Adiponectin (ACDC) is expressed in adipose tissue exclusively. It is similar to collagens X and VIII and complement factor C1q. Adiponectin circulates in the plasma and is involved with metabolic and hormonal processes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ACDC antibody (70R-1712) | ACDC antibody (70R-1712) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors