AChE antibody (70R-6078)

Rabbit polyclonal AChE antibody Yt blood group

Synonyms Polyclonal AChE antibody, Anti-AChE antibody, N-ACHE antibody, ARACHE antibody, Acetylcholinesterase antibody, YT antibody
Cross Reactivity Human
Applications WB
Immunogen AChE antibody was raised using a synthetic peptide corresponding to a region with amino acids VGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEA
Assay Information AChE Blocking Peptide, catalog no. 33R-9575, is also available for use as a blocking control in assays to test for specificity of this AChE antibody

Images

Western Blot analysis using AChE antibody (70R-6078)

AChE antibody (70R-6078) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACHE antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Acetylcholinesterase hydrolyzes the neurotransmitter, acetylcholine at neuromuscular junctions and brain cholinergic synapses, and thus terminates signal transmission. It is also found on the red blood cell membranes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using AChE antibody (70R-6078) | AChE antibody (70R-6078) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors