ACMSD antibody (70R-6311)

Rabbit polyclonal ACMSD antibody raised against the middle region of ACMSD

Synonyms Polyclonal ACMSD antibody, Anti-ACMSD antibody, Aminocarboxymuconate Semialdehyde Decarboxylase antibody
Specificity ACMSD antibody was raised against the middle region of ACMSD
Cross Reactivity Human
Applications WB
Immunogen ACMSD antibody was raised using the middle region of ACMSD corresponding to a region with amino acids NPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELE
Assay Information ACMSD Blocking Peptide, catalog no. 33R-6822, is also available for use as a blocking control in assays to test for specificity of this ACMSD antibody

Images

Western Blot analysis using ACMSD antibody (70R-6311)

ACMSD antibody (70R-6311) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACMSD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The neuronal excitotoxin quinolinate is an intermediate in the de novo synthesis pathway of NAD from tryptophan, and has been implicated in the pathogenesis of several neurodegenerative disorders.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ACMSD antibody (70R-6311) | ACMSD antibody (70R-6311) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors