ACOT11 antibody (70R-5866)

Rabbit polyclonal ACOT11 antibody raised against the middle region of ACOT11

Synonyms Polyclonal ACOT11 antibody, Anti-ACOT11 antibody, KIAA0707 antibody, BFIT2 antibody, Acyl-Coa Thioesterase 11 antibody, THEM1 antibody, BFIT1 antibody, THEA antibody, STARD14 antibody, BFIT antibody
Specificity ACOT11 antibody was raised against the middle region of ACOT11
Cross Reactivity Human
Applications WB
Immunogen ACOT11 antibody was raised using the middle region of ACOT11 corresponding to a region with amino acids AEKTRVESVELVLPPHANHQGNTFGGQIMAWMENVATIAASRLCRAHPTL
Assay Information ACOT11 Blocking Peptide, catalog no. 33R-1133, is also available for use as a blocking control in assays to test for specificity of this ACOT11 antibody

Images

Western Blot analysis using ACOT11 antibody (70R-5866)

ACOT11 antibody (70R-5866) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACOT11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACOT11 is a protein with acyl-CoA thioesterase activity towards medium (C12) and long-chain (C18) fatty acyl-CoA substrates. Expression of a similar murine protein in brown adipose tissue is induced by cold exposure and repressed by warmth.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ACOT11 antibody (70R-5866) | ACOT11 antibody (70R-5866) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors