ACOT12 antibody (70R-4138)

Rabbit polyclonal ACOT12 antibody raised against the middle region of ACOT12

Synonyms Polyclonal ACOT12 antibody, Anti-ACOT12 antibody, STARD15 antibody, CACH-1 antibody, THEAL antibody, Acyl-Coa Thioesterase 12 antibody, Cach antibody, MGC105114 antibody
Specificity ACOT12 antibody was raised against the middle region of ACOT12
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ACOT12 antibody was raised using the middle region of ACOT12 corresponding to a region with amino acids SASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRV
Assay Information ACOT12 Blocking Peptide, catalog no. 33R-8317, is also available for use as a blocking control in assays to test for specificity of this ACOT12 antibody


Western Blot analysis using ACOT12 antibody (70R-4138)

ACOT12 antibody (70R-4138) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACOT12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACOT12 contains 2 acyl coenzyme A hydrolase domains and 1 START domain. It hydrolyzes acetyl-CoA to acetate and CoA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ACOT12 antibody (70R-4138) | ACOT12 antibody (70R-4138) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors