ACOT2 antibody (70R-3930)

Rabbit polyclonal ACOT2 antibody raised against the middle region of ACOT2

Synonyms Polyclonal ACOT2 antibody, Anti-ACOT2 antibody, Acyl-Coa Thioesterase 2 antibody, Mte1 antibody, PTE2 antibody, ZAP128 antibody
Specificity ACOT2 antibody was raised against the middle region of ACOT2
Cross Reactivity Human
Applications WB
Immunogen ACOT2 antibody was raised using the middle region of ACOT2 corresponding to a region with amino acids SPLEGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGR
Assay Information ACOT2 Blocking Peptide, catalog no. 33R-8680, is also available for use as a blocking control in assays to test for specificity of this ACOT2 antibody

Images

Western Blot analysis using ACOT2 antibody (70R-3930)

ACOT2 antibody (70R-3930) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACOT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Acyl-CoA thioesterases, such as ACOT2, are a group of enzymes that hydrolyze CoA esters, such as acyl-CoAs, bile CoAs, and CoA esters of prostaglandins, to the corresponding free acid and CoA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ACOT2 antibody (70R-3930) | ACOT2 antibody (70R-3930) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors