ACP1 antibody (70R-3910)

Rabbit polyclonal ACP1 antibody raised against the middle region of ACP1

Synonyms Polyclonal ACP1 antibody, Anti-ACP1 antibody, MGC111030 antibody, Acid Phosphatase 1 Soluble antibody, MGC3499 antibody, HAAP antibody
Specificity ACP1 antibody was raised against the middle region of ACP1
Cross Reactivity Human
Applications WB
Immunogen ACP1 antibody was raised using the middle region of ACP1 corresponding to a region with amino acids NISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFA
Assay Information ACP1 Blocking Peptide, catalog no. 33R-6731, is also available for use as a blocking control in assays to test for specificity of this ACP1 antibody


Western Blot analysis using ACP1 antibody (70R-3910)

ACP1 antibody (70R-3910) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACP1 belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ACP1 antibody (70R-3910) | ACP1 antibody (70R-3910) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors