ACP2 antibody (70R-7341)

Rabbit polyclonal ACP2 antibody raised against the middle region of ACP2

Synonyms Polyclonal ACP2 antibody, Anti-ACP2 antibody, Acid Phosphatase 2 Lysosomal antibody
Specificity ACP2 antibody was raised against the middle region of ACP2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ACP2 antibody was raised using the middle region of ACP2 corresponding to a region with amino acids VPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANET
Assay Information ACP2 Blocking Peptide, catalog no. 33R-9731, is also available for use as a blocking control in assays to test for specificity of this ACP2 antibody

Images

Western blot analysis using ACP2 antibody (70R-7341)

Recommended ACP2 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACP2 is the beta subunit of lysosomal acid phosphatase (LAP). LAP is chemically and genetically distinct from red cell acid phosphatase. The protein belongs to a family of distinct isoenzymes which hydrolyze orthophosphoric monoesters to alcohol and phosphate. Mutations in this gene or in the related alpha subunit gene cause acid phosphatase deficiency.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using ACP2 antibody (70R-7341) | Recommended ACP2 Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using ACP2 antibody (70R-7341) | Liver

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors