ACPL2 antibody (70R-6409)

Rabbit polyclonal ACPL2 antibody raised against the middle region of ACPL2

Synonyms Polyclonal ACPL2 antibody, Anti-ACPL2 antibody, Acid Phosphatase-Like 2 antibody, FLJ23751 antibody
Specificity ACPL2 antibody was raised against the middle region of ACPL2
Cross Reactivity Human,Mouse
Applications WB
Immunogen ACPL2 antibody was raised using the middle region of ACPL2 corresponding to a region with amino acids SFESPLNSLPLYPNHPLCEMGELTQTGVVQHLQNGQLLRDIYLKKHKLLP
Assay Information ACPL2 Blocking Peptide, catalog no. 33R-8424, is also available for use as a blocking control in assays to test for specificity of this ACPL2 antibody


Western Blot analysis using ACPL2 antibody (70R-6409)

ACPL2 antibody (70R-6409) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACPL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of ACP protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ACPL2 antibody (70R-6409) | ACPL2 antibody (70R-6409) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors