ACPP antibody (70R-5707)

Rabbit polyclonal ACPP antibody raised against the middle region of ACPP

Synonyms Polyclonal ACPP antibody, Anti-ACPP antibody, ACP3 antibody, Acid Phosphatase Prostate antibody, ACP-3 antibody, PAP antibody
Specificity ACPP antibody was raised against the middle region of ACPP
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ACPP antibody was raised using the middle region of ACPP corresponding to a region with amino acids CESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLV
Assay Information ACPP Blocking Peptide, catalog no. 33R-1679, is also available for use as a blocking control in assays to test for specificity of this ACPP antibody

Images

Western Blot analysis using ACPP antibody (70R-5707)

ACPP antibody (70R-5707) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACPP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes an enzyme that catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is synthesized under androgen regulation and is secreted by the epithelial cells of the prostate gland.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ACPP antibody (70R-5707) | ACPP antibody (70R-5707) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors