ACSL1 antibody (70R-6456)

Rabbit polyclonal ACSL1 antibody raised against the N terminal of ACSL1

Synonyms Polyclonal ACSL1 antibody, Anti-ACSL1 antibody, ACS1 antibody, FACL1 antibody, FACL2 antibody, LACS antibody, LACS1 antibody, Acyl-Coa Synthetase Long-Chain Family Member 1 antibody, LACS2 antibody
Specificity ACSL1 antibody was raised against the N terminal of ACSL1
Cross Reactivity Human
Applications WB
Immunogen ACSL1 antibody was raised using the N terminal of ACSL1 corresponding to a region with amino acids ALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSY
Assay Information ACSL1 Blocking Peptide, catalog no. 33R-1349, is also available for use as a blocking control in assays to test for specificity of this ACSL1 antibody


Western Blot analysis using ACSL1 antibody (70R-6456)

ACSL1 antibody (70R-6456) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 78 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACSL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ACSL1 antibody (70R-6456) | ACSL1 antibody (70R-6456) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors