ACSL3 antibody (70R-6570)

Rabbit polyclonal ACSL3 antibody raised against the N terminal of ACSL3

Synonyms Polyclonal ACSL3 antibody, Anti-ACSL3 antibody, Acyl-Coa Synthetase Long-Chain Family Member 3 antibody, FACL3 antibody, PRO2194 antibody, ACS3 antibody
Specificity ACSL3 antibody was raised against the N terminal of ACSL3
Cross Reactivity Human,Mouse
Applications WB
Immunogen ACSL3 antibody was raised using the N terminal of ACSL3 corresponding to a region with amino acids LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI
Assay Information ACSL3 Blocking Peptide, catalog no. 33R-4845, is also available for use as a blocking control in assays to test for specificity of this ACSL3 antibody

Images

Western Blot analysis using ACSL3 antibody (70R-6570)

ACSL3 antibody (70R-6570) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACSL3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACSL3 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ACSL3 antibody (70R-6570) | ACSL3 antibody (70R-6570) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors