ACTA1 Blocking Peptide (33R-10409)

A synthetic peptide for use as a blocking control in assays to test for specificity of ACTA1 antibody, catalog no. 70R-10210

Synonyms ACTA1 control peptide, ACTA1 antibody Blocking Peptide, Anti-ACTA1 Blocking Peptide, actin, alpha 1, skeletal muscle Blocking Peptide, ACTA Blocking Peptide, ASMA Blocking Peptide, CFTD Blocking Peptide, CFTD1 Blocking Peptide, CFTDM Blocking Peptide, MPFD Blocking Peptide, NEM1 Blocking Peptide, NEM2 Blocking Peptide, NEM3 Blocking Peptide, ACTA1, ACTA-1, ACTA 1, ACTA-1 Blocking Peptide, ACTA 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues STMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHR
Molecular Weight 42 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The product encoded by this gene belongs to the actin family of proteins, which are highly conserved proteins that play a role in cell motility, structure and integrity. Alpha, beta and gamma actin isoforms have been identified, with alpha actins being a major constituent of the contractile apparatus, while beta and gamma actins are involved in the regulation of cell motility. This actin is an alpha actin that is found in skeletal muscle. Mutations in this gene cause nemaline myopathy type 3, congenital myopathy with excess of thin myofilaments, congenital myopathy with cores, and congenital myopathy with fiber-type disproportion, diseases that lead to muscle fiber defects.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors