ACTL6B antibody (70R-3899)

Rabbit polyclonal ACTL6B antibody raised against the middle region of ACTL6B

Synonyms Polyclonal ACTL6B antibody, Anti-ACTL6B antibody, Actin-Like 6B antibody, BAF53B antibody, ACTL6 antibody
Specificity ACTL6B antibody was raised against the middle region of ACTL6B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ACTL6B antibody was raised using the middle region of ACTL6B corresponding to a region with amino acids GHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPS
Assay Information ACTL6B Blocking Peptide, catalog no. 33R-3319, is also available for use as a blocking control in assays to test for specificity of this ACTL6B antibody


Western Blot analysis using ACTL6B antibody (70R-3899)

ACTL6B antibody (70R-3899) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACTL6B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ACTL6B antibody (70R-3899) | ACTL6B antibody (70R-3899) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors