ACTR10 antibody (70R-4376)

Rabbit polyclonal ACTR10 antibody

Synonyms Polyclonal ACTR10 antibody, Anti-ACTR10 antibody, ACTR11 antibody, HARP11 antibody, Actin-Related Protein 10 Homolog antibody
Cross Reactivity Human
Applications WB
Immunogen ACTR10 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLIQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKAL
Assay Information ACTR10 Blocking Peptide, catalog no. 33R-8598, is also available for use as a blocking control in assays to test for specificity of this ACTR10 antibody


Western Blot analysis using ACTR10 antibody (70R-4376)

ACTR10 antibody (70R-4376) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACTR10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACTR10 may be involved in protein binding.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ACTR10 antibody (70R-4376) | ACTR10 antibody (70R-4376) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors