ACTR3 antibody (70R-3336)

Rabbit polyclonal ACTR3 antibody

Synonyms Polyclonal ACTR3 antibody, Anti-ACTR3 antibody, Arp3 Actin-Related Protein 3 Homolog antibody, ARP3 antibody
Cross Reactivity Human
Applications WB
Immunogen ACTR3 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVE
Assay Information ACTR3 Blocking Peptide, catalog no. 33R-3891, is also available for use as a blocking control in assays to test for specificity of this ACTR3 antibody

Images

Western Blot analysis using ACTR3 antibody (70R-3336)

ACTR3 antibody (70R-3336) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACTR3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of this gene has not yet been determined; however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ACTR3 antibody (70R-3336) | ACTR3 antibody (70R-3336) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors