ACTR3B antibody (70R-3557)

Rabbit polyclonal ACTR3B antibody

Synonyms Polyclonal ACTR3B antibody, Anti-ACTR3B antibody, DKFZp686O24114 antibody, ARP3BETA antibody, Arp3 Actin-Related Protein 3 Homolog B antibody, ARP11 antibody
Cross Reactivity Human
Applications WB
Immunogen ACTR3B antibody was raised using a synthetic peptide corresponding to a region with amino acids MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRR
Assay Information ACTR3B Blocking Peptide, catalog no. 33R-5669, is also available for use as a blocking control in assays to test for specificity of this ACTR3B antibody

Images

Western Blot analysis using ACTR3B antibody (70R-3557)

ACTR3B antibody (70R-3557) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACTR3B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACTR3B may function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ACTR3B may decrease the metastatic potential of tumors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ACTR3B antibody (70R-3557) | ACTR3B antibody (70R-3557) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors