ACTRT1 antibody (70R-3289)

Rabbit polyclonal ACTRT1 antibody raised against the middle region of ACTRT1

Synonyms Polyclonal ACTRT1 antibody, Anti-ACTRT1 antibody, KIAA0705 antibody, ARP-T1 antibody, Actin-Related Protein T1 antibody, ARIP1 antibody, MGC26590 antibody, HSD27 antibody, ARPT1 antibody, AIP1 antibody
Specificity ACTRT1 antibody was raised against the middle region of ACTRT1
Cross Reactivity Human
Applications WB
Immunogen ACTRT1 antibody was raised using the middle region of ACTRT1 corresponding to a region with amino acids DTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDR
Assay Information ACTRT1 Blocking Peptide, catalog no. 33R-2189, is also available for use as a blocking control in assays to test for specificity of this ACTRT1 antibody

Images

Western Blot analysis using ACTRT1 antibody (70R-3289)

ACTRT1 antibody (70R-3289) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACTRT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of ACTRT1 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ACTRT1 antibody (70R-3289) | ACTRT1 antibody (70R-3289) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors