ACVR1 antibody (70R-7319)

Rabbit polyclonal ACVR1 antibody raised against the N terminal of ACVR1

Synonyms Polyclonal ACVR1 antibody, Anti-ACVR1 antibody, FOP antibody, Activin A Receptor Type I antibody, SKR1 antibody, ACTRI antibody, ACVRLK2 antibody, ALK2 antibody
Specificity ACVR1 antibody was raised against the N terminal of ACVR1
Cross Reactivity Human,Mouse
Applications WB
Immunogen ACVR1 antibody was raised using the N terminal of ACVR1 corresponding to a region with amino acids EGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSP
Assay Information ACVR1 Blocking Peptide, catalog no. 33R-2439, is also available for use as a blocking control in assays to test for specificity of this ACVR1 antibody


Western Blot analysis using ACVR1 antibody (70R-7319)

ACVR1 antibody (70R-7319) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACVR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Activin receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. ACVR1 is activin A type I receptor which signals a particular transcriptional response in concert with activin type II receptors.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ACVR1 antibody (70R-7319) | ACVR1 antibody (70R-7319) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors