ACVR1C antibody (70R-7481)

Rabbit polyclonal ACVR1C antibody raised against the N terminal of ACVR1C

Synonyms Polyclonal ACVR1C antibody, Anti-ACVR1C antibody, ACVRLK7 antibody, ALK7 antibody, Activin A Receptor Type Ic antibody
Specificity ACVR1C antibody was raised against the N terminal of ACVR1C
Cross Reactivity Human
Applications WB
Immunogen ACVR1C antibody was raised using the N terminal of ACVR1C corresponding to a region with amino acids QVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITVP
Assay Information ACVR1C Blocking Peptide, catalog no. 33R-7772, is also available for use as a blocking control in assays to test for specificity of this ACVR1C antibody

Images

Western Blot analysis using ACVR1C antibody (70R-7481)

ACVR1C antibody (70R-7481) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACVR1C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACVR1C is a type I receptor for the TGFB family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ACVR1C antibody (70R-7481) | ACVR1C antibody (70R-7481) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors