ACVR2B antibody (70R-7464)

Rabbit polyclonal ACVR2B antibody raised against the middle region of ACVR2B

Synonyms Polyclonal ACVR2B antibody, Anti-ACVR2B antibody, Activin A Receptor Type Iib antibody, ACTRIIB antibody, MGC116908 antibody, ActR-IIB antibody
Specificity ACVR2B antibody was raised against the middle region of ACVR2B
Cross Reactivity Human
Applications WB
Immunogen ACVR2B antibody was raised using the middle region of ACVR2B corresponding to a region with amino acids LCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAV
Assay Information ACVR2B Blocking Peptide, catalog no. 33R-4822, is also available for use as a blocking control in assays to test for specificity of this ACVR2B antibody


Western Blot analysis using ACVR2B antibody (70R-7464)

ACVR2B antibody (70R-7464) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACVR2B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Activin receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ACVR2B antibody (70R-7464) | ACVR2B antibody (70R-7464) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors