ACVRL1 antibody (70R-7473)

Rabbit polyclonal ACVRL1 antibody raised against the N terminal of ACVRL1

Synonyms Polyclonal ACVRL1 antibody, Anti-ACVRL1 antibody, HHT2 antibody, Activin A Receptor Type Ii-Like 1 antibody, ACVRLK1 antibody, ORW2 antibody, ALK-1 antibody, ALK1 antibody, HHT antibody, SKR3 antibody, TSR-I antibody
Specificity ACVRL1 antibody was raised against the N terminal of ACVRL1
Cross Reactivity Human
Applications WB
Immunogen ACVRL1 antibody was raised using the N terminal of ACVRL1 corresponding to a region with amino acids SPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNH
Assay Information ACVRL1 Blocking Peptide, catalog no. 33R-8676, is also available for use as a blocking control in assays to test for specificity of this ACVRL1 antibody

Images

Western Blot analysis using ACVRL1 antibody (70R-7473)

ACVRL1 antibody (70R-7473) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACVRL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACVRL1 is a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. ACVRL1, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ACVRL1 antibody (70R-7473) | ACVRL1 antibody (70R-7473) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors