ADAD2 antibody (70R-4921)

Rabbit polyclonal ADAD2 antibody raised against the C terminal of ADAD2

Synonyms Polyclonal ADAD2 antibody, Anti-ADAD2 antibody, TENRL antibody, Adenosine Deaminase Domain Containing 2 antibody, FLJ00337 antibody
Specificity ADAD2 antibody was raised against the C terminal of ADAD2
Cross Reactivity Human
Applications WB
Immunogen ADAD2 antibody was raised using the C terminal of ADAD2 corresponding to a region with amino acids TPDTCRGLSLNWSLGDPGIEVVDVATGRVKANAALGPPSRLCKASFLRAF
Assay Information ADAD2 Blocking Peptide, catalog no. 33R-9218, is also available for use as a blocking control in assays to test for specificity of this ADAD2 antibody


Western Blot analysis using ADAD2 antibody (70R-4921)

ADAD2 antibody (70R-4921) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADAD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ADAD2 belongs to the ADAD family, and contains 1 A to I editase domain and 1 DRBM (double-stranded RNA-binding) domain. The exact functions of ADAD2 remain unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ADAD2 antibody (70R-4921) | ADAD2 antibody (70R-4921) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors