ADAM2 antibody (70R-6129)

Rabbit polyclonal ADAM2 antibody

Synonyms Polyclonal ADAM2 antibody, Anti-ADAM2 antibody, Fertilin Beta antibody, CRYN1 antibody, Adam Metallopeptidase Domain 2 antibody, PH30 antibody, CRYN2 antibody, PH-30b antibody, FTNB antibody
Cross Reactivity Human
Applications WB
Immunogen ADAM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVIL
Assay Information ADAM2 Blocking Peptide, catalog no. 33R-7144, is also available for use as a blocking control in assays to test for specificity of this ADAM2 antibody

Images

Western Blot analysis using ADAM2 antibody (70R-6129)

ADAM2 antibody (70R-6129) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 81 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADAM2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ADAM2 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM2 is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ADAM2 antibody (70R-6129) | ADAM2 antibody (70R-6129) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors