ADAM30 antibody (70R-7288)

Rabbit polyclonal ADAM30 antibody raised against the N terminal of ADAM30

Synonyms Polyclonal ADAM30 antibody, Anti-ADAM30 antibody, svph4 antibody, Adam Metallopeptidase Domain 30 antibody
Specificity ADAM30 antibody was raised against the N terminal of ADAM30
Cross Reactivity Human
Applications WB
Immunogen ADAM30 antibody was raised using the N terminal of ADAM30 corresponding to a region with amino acids IEWQMAPYENKARLRDFPGSYKHPKYLELILLFDQSRYRFVNNNLSQVIH
Assay Information ADAM30 Blocking Peptide, catalog no. 33R-3955, is also available for use as a blocking control in assays to test for specificity of this ADAM30 antibody

Images

Western Blot analysis using ADAM30 antibody (70R-7288)

ADAM30 antibody (70R-7288) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADAM30 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ADAM30 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ADAM30 antibody (70R-7288) | ADAM30 antibody (70R-7288) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors