ADAM33 antibody (70R-5976)

Rabbit polyclonal ADAM33 antibody raised against the middle region of ADAM33

Synonyms Polyclonal ADAM33 antibody, Anti-ADAM33 antibody, DKFZp434K0521 antibody, Adam Metallopeptidase Domain 33 antibody, FLJ35308 antibody, FLJ36751 antibody, DJ964F7.1 antibody, MGC71889 antibody, MGC149823 antibody
Specificity ADAM33 antibody was raised against the middle region of ADAM33
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ADAM33 antibody was raised using the middle region of ADAM33 corresponding to a region with amino acids HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA
Assay Information ADAM33 Blocking Peptide, catalog no. 33R-3711, is also available for use as a blocking control in assays to test for specificity of this ADAM33 antibody

Images

Western Blot analysis using ADAM33 antibody (70R-5976)

ADAM33 antibody (70R-5976) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADAM33 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ADAM33 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM33 is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ADAM33 antibody (70R-5976) | ADAM33 antibody (70R-5976) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors