ADAMDEC1 antibody (70R-6062)

Rabbit polyclonal ADAMDEC1 antibody raised against the middle region of ADAMDEC1

Synonyms Polyclonal ADAMDEC1 antibody, Anti-ADAMDEC1 antibody, M12.219 antibody, Adam-Like Decysin 1 antibody
Specificity ADAMDEC1 antibody was raised against the middle region of ADAMDEC1
Cross Reactivity Human
Applications WB
Immunogen ADAMDEC1 antibody was raised using the middle region of ADAMDEC1 corresponding to a region with amino acids GMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCL
Assay Information ADAMDEC1 Blocking Peptide, catalog no. 33R-3436, is also available for use as a blocking control in assays to test for specificity of this ADAMDEC1 antibody

Images

Western Blot analysis using ADAMDEC1 antibody (70R-6062)

ADAMDEC1 antibody (70R-6062) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADAMDEC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ADAMDEC1 antibody (70R-6062) | ADAMDEC1 antibody (70R-6062) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors