ADAMTS4 antibody (70R-2304)

Rabbit polyclonal ADAMTS4 antibody raised against the N terminal of ADAMTS4

Synonyms Polyclonal ADAMTS4 antibody, Anti-ADAMTS4 antibody, ADMP-1 antibody, Adam Metallopeptidase With Thrombospondin Type 1 Motif 4 antibody, KIAA0688 antibody, ADAMTS-4 antibody, ADAMTS-2 antibody
Specificity ADAMTS4 antibody was raised against the N terminal of ADAMTS4
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen ADAMTS4 antibody was raised using the N terminal of ADAMTS4 corresponding to a region with amino acids GVQVEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALL
Assay Information ADAMTS4 Blocking Peptide, catalog no. 33R-3654, is also available for use as a blocking control in assays to test for specificity of this ADAMTS4 antibody

Images

Western Blot analysis using ADAMTS4 antibody (70R-2304)

ADAMTS4 antibody (70R-2304) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADAMTS4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ADAMTS4 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. ADAMTS4 lacks a C-terminal TS motif. It is responsible for the degradation of aggrecan, a major proteoglycan of cartilage, and brevican, a brain-specific extracellular matrix protein. The cleavage of aggrecan and brevican suggests key roles of this enzyme in arthritic disease and in the central nervous system, potentially, in the progression of glioma.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ADAMTS4 antibody (70R-2304) | ADAMTS4 antibody (70R-2304) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors