ADARB1 antibody (70R-1550)

Rabbit polyclonal ADARB1 antibody

Synonyms Polyclonal ADARB1 antibody, Anti-ADARB1 antibody, RED1 homolog antibody, Adenosine Deaminase Rna-Specific B1 antibody
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI
Assay Information ADARB1 Blocking Peptide, catalog no. 33R-7645, is also available for use as a blocking control in assays to test for specificity of this ADARB1 antibody


Western Blot analysis using ADARB1 antibody (70R-1550)

ADARB1 antibody (70R-1550) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 77 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ADARB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ADARB1 is an enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ADARB1 antibody (70R-1550) | ADARB1 antibody (70R-1550) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors