ADARB2 antibody (70R-4957)

Rabbit polyclonal ADARB2 antibody

Synonyms Polyclonal ADARB2 antibody, Anti-ADARB2 antibody, Adenosine Deaminase Rna-Specific B2 antibody, FLJ36975 antibody, hRED2 antibody, ADAR3 antibody, FLJ25034 antibody, RED2 antibody, RED2 homolog antibody
Cross Reactivity Human
Applications WB
Immunogen ADARB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCG
Assay Information ADARB2 Blocking Peptide, catalog no. 33R-8954, is also available for use as a blocking control in assays to test for specificity of this ADARB2 antibody


Western Blot analysis using ADARB2 antibody (70R-4957)

ADARB2 antibody (70R-4957) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADARB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ADARB2 is a member of the double-stranded RNA adenosine deaminase family of RNA-editing enzymes and may play a regulatory role in RNA editing.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ADARB2 antibody (70R-4957) | ADARB2 antibody (70R-4957) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors