ADAT1 antibody (70R-4703)

Rabbit polyclonal ADAT1 antibody raised against the C terminal of ADAT1

Synonyms Polyclonal ADAT1 antibody, Anti-ADAT1 antibody, Adenosine Deaminase tRNA-Specific 1 antibody, HADAT1 antibody
Specificity ADAT1 antibody was raised against the C terminal of ADAT1
Cross Reactivity Human
Applications IHC, WB
Immunogen ADAT1 antibody was raised using the C terminal of ADAT1 corresponding to a region with amino acids LFRSFQKLLSRIARDKWPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQV
Assay Information ADAT1 Blocking Peptide, catalog no. 33R-4947, is also available for use as a blocking control in assays to test for specificity of this ADAT1 antibody


Immunohistochemical staining using ADAT1 antibody (70R-4703)

ADAT1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of fundic gland (arrows) in Human Stomach. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADAT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ADAT1 is a member of the ADAR (adenosine deaminase acting on RNA) family. Using site-specific adenosine modification, the family participates in the pre-mRNA editing of nuclear transcripts. ADAT1, tRNA-specific adenosine deaminase 1, is responsible for the deamination of adenosine 37 to inosine in eukaryotic tRNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using ADAT1 antibody (70R-4703) | ADAT1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of fundic gland (arrows) in Human Stomach. Magnification is at 400X
  • Western Blot analysis using ADAT1 antibody (70R-4703) | ADAT1 antibody (70R-4703) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors