ADC antibody (70R-3996)

Rabbit polyclonal ADC antibody raised against the middle region of ADC

Synonyms Polyclonal ADC antibody, Anti-ADC antibody, KIAA1945 antibody, AZI2 antibody, Arginine Decarboxylase antibody, ODC1L antibody, ODC-p antibody
Specificity ADC antibody was raised against the middle region of ADC
Cross Reactivity Human
Applications WB
Immunogen ADC antibody was raised using the middle region of ADC corresponding to a region with amino acids RHLLENAKKHHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGH
Assay Information ADC Blocking Peptide, catalog no. 33R-7951, is also available for use as a blocking control in assays to test for specificity of this ADC antibody

Images

Western Blot analysis using ADC antibody (70R-3996)

ADC antibody (70R-3996) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ADC decarboxylates L-arginine to agmatine. Truncated splice isoforms probably lack activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ADC antibody (70R-3996) | ADC antibody (70R-3996) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors