ADCY6 antibody (70R-5955)

Rabbit polyclonal ADCY6 antibody raised against the C terminal of ADCY6

Synonyms Polyclonal ADCY6 antibody, Anti-ADCY6 antibody, KIAA0422 antibody, Adenylate Cyclase 6 antibody, DKFZp779F075 antibody
Specificity ADCY6 antibody was raised against the C terminal of ADCY6
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ADCY6 antibody was raised using the C terminal of ADCY6 corresponding to a region with amino acids LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY
Assay Information ADCY6 Blocking Peptide, catalog no. 33R-5069, is also available for use as a blocking control in assays to test for specificity of this ADCY6 antibody

Images

Western Blot analysis using ADCY6 antibody (70R-5955)

ADCY6 antibody (70R-5955) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 125 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADCY6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ADCY6 is adenylate cyclase 6, which is a membrane-associated enzyme and catalyzes the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). The expression of ADCY6 is found in normal thyroid and brain tissues, as well as some tumors; and its expression is significantly higher in one hyperfunctioning thyroid tumor than in normal thyroid tissue.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ADCY6 antibody (70R-5955) | ADCY6 antibody (70R-5955) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors