ADCY8 antibody (70R-5957)

Rabbit polyclonal ADCY8 antibody

Synonyms Polyclonal ADCY8 antibody, Anti-ADCY8 antibody, ADCY3 antibody, HBAC1 antibody, Adenylate Cyclase 8 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ADCY8 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQ
Assay Information ADCY8 Blocking Peptide, catalog no. 33R-2494, is also available for use as a blocking control in assays to test for specificity of this ADCY8 antibody


Western Blot analysis using ADCY8 antibody (70R-5957)

ADCY8 antibody (70R-5957) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 140 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADCY8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Adenylate cyclase is a membrane bound enzyme that catalyses the formation of cyclic AMP from ATP. The enzymatic activity is under the control of several hormones, and different polypeptides participate in the transduction of the signal from the receptor to the catalytic moiety. Stimulatory or inhibitory receptors (Rs and Ri) interact with G proteins (Gs and Gi) that exhibit GTPase activity and they modulate the activity of the catalytic subunit of the adenylyl cyclase.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ADCY8 antibody (70R-5957) | ADCY8 antibody (70R-5957) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors