ADH1A antibody (70R-3919)

Rabbit polyclonal ADH1A antibody

Synonyms Polyclonal ADH1A antibody, Anti-ADH1A antibody, Alcohol Dehydrogenase 1A antibody, ADH-1 antibody, Alcohol Dehydrogenase Class I alpha polypeptide antibody, ADH1 antibody
Cross Reactivity Human
Applications WB
Immunogen ADH1A antibody was raised using a synthetic peptide corresponding to a region with amino acids NYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVA
Assay Information ADH1A Blocking Peptide, catalog no. 33R-6935, is also available for use as a blocking control in assays to test for specificity of this ADH1A antibody


Western Blot analysis using ADH1A antibody (70R-3919)

ADH1A antibody (70R-3919) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADH1A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ADH1A is class I alcohol dehydrogenase, alpha subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ADH1A antibody (70R-3919) | ADH1A antibody (70R-3919) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors