ADH4 antibody (70R-1191)

Rabbit polyclonal ADH4 antibody

Synonyms Polyclonal ADH4 antibody, Anti-ADH4 antibody, Alcohol Dehydrogenase Class II pi polypeptide antibody, Alcohol Dehydrogenase 4 antibody, ADH-2 antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen ADH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSET
Assay Information ADH4 Blocking Peptide, catalog no. 33R-6872, is also available for use as a blocking control in assays to test for specificity of this ADH4 antibody

Images

Western Blot analysis using ADH4 antibody (70R-1191)

ADH4 antibody (70R-1191) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ADH4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ADH4, class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ADH4 antibody (70R-1191) | ADH4 antibody (70R-1191) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using ADH4 antibody (70R-1191) | ADH4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors