ADRB1 antibody (70R-5939)

Rabbit polyclonal ADRB1 antibody raised against the middle region of ADRB1

Synonyms Polyclonal ADRB1 antibody, Anti-ADRB1 antibody, BETA1AR antibody, ADRB1R antibody, Adrenergic Beta-1- Receptor antibody, RHR antibody, B1AR antibody
Specificity ADRB1 antibody was raised against the middle region of ADRB1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ADRB1 antibody was raised using the middle region of ADRB1 corresponding to a region with amino acids CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
Assay Information ADRB1 Blocking Peptide, catalog no. 33R-1826, is also available for use as a blocking control in assays to test for specificity of this ADRB1 antibody

Images

Western Blot analysis using ADRB1 antibody (70R-5939)

ADRB1 antibody (70R-5939) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADRB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in ADRB1 gene have been shown to affect the resting heart rate and can be involved in heart failure.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ADRB1 antibody (70R-5939) | ADRB1 antibody (70R-5939) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors