ADRBK1 antibody (70R-4033)

Rabbit polyclonal ADRBK1 antibody raised against the N terminal of ADRBK1

Synonyms Polyclonal ADRBK1 antibody, Anti-ADRBK1 antibody, FLJ16718 antibody, Adrenergic Beta Receptor Kinase 1 antibody, BARK1 antibody, BETA-ARK1 antibody, GRK2 antibody
Specificity ADRBK1 antibody was raised against the N terminal of ADRBK1
Cross Reactivity Human
Applications WB
Immunogen ADRBK1 antibody was raised using the N terminal of ADRBK1 corresponding to a region with amino acids PEPSIRSVMQKYLEDRGEVTFEKIFSQKLGYLLFRDFCLNHLEEARPLVE
Assay Information ADRBK1 Blocking Peptide, catalog no. 33R-7058, is also available for use as a blocking control in assays to test for specificity of this ADRBK1 antibody


Western Blot analysis using ADRBK1 antibody (70R-4033)

ADRBK1 antibody (70R-4033) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 79 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADRBK1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The product of this gene phosphorylates the beta-2-adrenergic receptor and appears to mediate agonist-specific desensitization observed at high agonist concentrations. This protein is an ubiquitous cytosolic enzyme that specifically phosphorylates the activated form of the beta-adrenergic and related G-protein-coupled receptors. Abnormal coupling of beta-adrenergic receptor to G protein is involved in the pathogenesis of the failing heart.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ADRBK1 antibody (70R-4033) | ADRBK1 antibody (70R-4033) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors