ADRBK2 antibody (70R-3665)

Rabbit polyclonal ADRBK2 antibody raised against the N terminal of ADRBK2

Synonyms Polyclonal ADRBK2 antibody, Anti-ADRBK2 antibody, BARK2 antibody, Adrenergic Beta Receptor Kinase 2 antibody, GRK3 antibody
Specificity ADRBK2 antibody was raised against the N terminal of ADRBK2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ADRBK2 antibody was raised using the N terminal of ADRBK2 corresponding to a region with amino acids FCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSC
Assay Information ADRBK2 Blocking Peptide, catalog no. 33R-2854, is also available for use as a blocking control in assays to test for specificity of this ADRBK2 antibody

Images

Western Blot analysis using ADRBK2 antibody (70R-3665)

Western Blot showing ADRBK2 antibody used at a concentration of 1-2 ug/ml to detect its target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADRBK2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.2-1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ADRBK2 specifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ADRBK2 antibody (70R-3665) | Western Blot showing ADRBK2 antibody used at a concentration of 1-2 ug/ml to detect its target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors