AFG3L2 antibody (70R-6480)

Rabbit polyclonal AFG3L2 antibody

Synonyms Polyclonal AFG3L2 antibody, Anti-AFG3L2 antibody, Afg3 Atpase Family Gene 3-Like 2 antibody, FLJ25993 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen AFG3L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVS
Assay Information AFG3L2 Blocking Peptide, catalog no. 33R-9704, is also available for use as a blocking control in assays to test for specificity of this AFG3L2 antibody

Images

Western Blot analysis using AFG3L2 antibody (70R-6480)

AFG3L2 antibody (70R-6480) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 88 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AFG3L2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AFG3L2 is a protein localized in mitochondria and closely related to paraplegin. The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia. AFG3L2 gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using AFG3L2 antibody (70R-6480) | AFG3L2 antibody (70R-6480) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors