AGA Blocking Peptide (33R-10401)

A synthetic peptide for use as a blocking control in assays to test for specificity of AGA antibody, catalog no. 70R-10228

Synonyms AGA control peptide, AGA antibody Blocking Peptide, Anti-AGA Blocking Peptide, aspartylglucosaminidase Blocking Peptide, AGU Blocking Peptide, ASRG Blocking Peptide, GA Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SMGFINEDLSTTASQALHSDWLARNCQPNYWRNVIPDPSKYCGPYKPPGI
Molecular Weight 36 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Aspartylglucosaminidase is involved in the catabolism of N-linked oligosaccharides of glycoproteins. It cleaves asparagine from N-acetylglucosamines as one of the final steps in the lysosomal breakdown of glycoproteins. The lysosomal storage disease aspartylglycosaminuria is caused by a deficiency in the AGA enzyme.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors