AGBL5 antibody (70R-1956)

Rabbit polyclonal AGBL5 antibody raised against the C terminal of AGBL5

Synonyms Polyclonal AGBL5 antibody, Anti-AGBL5 antibody, Atp/Gtp Binding Protein-Like 5 antibody, FLJ21839 antibody
Specificity AGBL5 antibody was raised against the C terminal of AGBL5
Cross Reactivity Human
Applications WB
Immunogen AGBL5 antibody was raised using the C terminal of AGBL5 corresponding to a region with amino acids NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS
Assay Information AGBL5 Blocking Peptide, catalog no. 33R-6772, is also available for use as a blocking control in assays to test for specificity of this AGBL5 antibody

Images

Western Blot analysis using AGBL5 antibody (70R-1956)

AGBL5 antibody (70R-1956) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AGBL5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AGBL5 belongs to the peptidase M14 family. The exact function of AGBL5 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using AGBL5 antibody (70R-1956) | AGBL5 antibody (70R-1956) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors