AGK antibody (70R-3532)

Rabbit polyclonal AGK antibody raised against the N terminal of AGK

Synonyms Polyclonal AGK antibody, Anti-AGK antibody, MULK antibody, Acylglycerol Kinase antibody, FLJ10842 antibody
Specificity AGK antibody was raised against the N terminal of AGK
Cross Reactivity Human
Applications WB
Immunogen AGK antibody was raised using the N terminal of AGK corresponding to a region with amino acids KKLLELMENTDVIIVAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGE
Assay Information AGK Blocking Peptide, catalog no. 33R-4482, is also available for use as a blocking control in assays to test for specificity of this AGK antibody

Images

Western Blot analysis using AGK antibody (70R-3532)

AGK antibody (70R-3532) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AGK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AGK is a lipid kinase that can phosphorylate both monoacylglycerol and diacylglycerol to form lysophosphatidic acid (LPA) and phosphatidic acid (PA), respectively. AGK does not phosphorylate sphingosine. Overexpression of AGK increases the formation and secretion of LPA, resulting in transactivation of EGFR and activation of the downstream MAPK signaling pathway, leading to increased cell growth.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using AGK antibody (70R-3532) | AGK antibody (70R-3532) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors