AGT antibody (70R-6214)

Rabbit polyclonal AGT antibody

Synonyms Polyclonal AGT antibody, Anti-AGT antibody, Angiotensinogen antibody, ANHU antibody, SERPINA8 antibody, Serpin Peptidase Inhibitor Clade A 8 antibody
Cross Reactivity Human
Applications WB
Immunogen AGT antibody was raised using a synthetic peptide corresponding to a region with amino acids IHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQ
Assay Information AGT Blocking Peptide, catalog no. 33R-3985, is also available for use as a blocking control in assays to test for specificity of this AGT antibody

Images

Western Blot analysis using AGT antibody (70R-6214)

AGT antibody (70R-6214) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AGT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AGT, pre-angiotensinogen or angiotensinogen precursor, is expressed in the liver and is cleaved by the enzyme renin in response to lowered blood pressure. The resulting product, angiotensin I, is then cleaved by angiotensin converting enzyme (ACE) to generate the physiologically active enzyme angiotensin II. The protein is involved in maintaining blood pressure and in the pathogenesis of essential hypertension and preeclampsia. Mutations in this gene are associated with susceptibility to essential hypertension, and can cause renal tubular dysgenesis, a severe disorder of renal tubular development. Defects in this gene have also been associated with non-familial structural atrial fibrillation, and inflammatory bowel disease.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using AGT antibody (70R-6214) | AGT antibody (70R-6214) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors