AHCYL1 antibody (70R-3883)

Rabbit polyclonal AHCYL1 antibody raised against the N terminal of AHCYL1

Synonyms Polyclonal AHCYL1 antibody, Anti-AHCYL1 antibody, PRO0233 antibody, IRBIT antibody, DCAL antibody, S-Adenosylhomocysteine Hydrolase-Like 1 antibody, XPVKONA antibody
Specificity AHCYL1 antibody was raised against the N terminal of AHCYL1
Cross Reactivity Human,Mouse
Applications WB
Immunogen AHCYL1 antibody was raised using the N terminal of AHCYL1 corresponding to a region with amino acids MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQE
Assay Information AHCYL1 Blocking Peptide, catalog no. 33R-6472, is also available for use as a blocking control in assays to test for specificity of this AHCYL1 antibody


Western Blot analysis using AHCYL1 antibody (70R-3883)

AHCYL1 antibody (70R-3883) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AHCYL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AHCYL1 belongs to the adenosylhomocysteinase family.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AHCYL1 antibody (70R-3883) | AHCYL1 antibody (70R-3883) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors