AK1 antibody (70R-2397)

Rabbit polyclonal AK1 antibody raised against the middle region of AK1

Synonyms Polyclonal AK1 antibody, Anti-AK1 antibody, Adenylate Kinase 1 antibody
Specificity AK1 antibody was raised against the middle region of AK1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen AK1 antibody was raised using the middle region of AK1 corresponding to a region with amino acids RIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKAT
Assay Information AK1 Blocking Peptide, catalog no. 33R-7966, is also available for use as a blocking control in assays to test for specificity of this AK1 antibody

Western Blot analysis using AK1 antibody (70R-2397)

AK1 antibody (70R-2397) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AK1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using AK1 antibody (70R-2397) | AK1 antibody (70R-2397) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors