AK3L1 antibody (70R-1088)

Rabbit polyclonal AK3L1 antibody raised against the middle region of AK3L1

Synonyms Polyclonal AK3L1 antibody, Anti-AK3L1 antibody, AK3 antibody, AK4 antibody, Adenylate Kinase 3-Like 1 antibody
Specificity AK3L1 antibody was raised against the middle region of AK3L1
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen AK3L1 antibody was raised using the middle region of AK3L1 corresponding to a region with amino acids RWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYK
Assay Information AK3L1 Blocking Peptide, catalog no. 33R-8265, is also available for use as a blocking control in assays to test for specificity of this AK3L1 antibody

Images

Western Blot analysis using AK3L1 antibody (70R-1088)

AK3L1 antibody (70R-1088) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of AK3L1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AK3L1 is a member of the adenylate kinase family of enzymes. The protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using AK3L1 antibody (70R-1088) | AK3L1 antibody (70R-1088) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors