AK5 antibody (70R-3556)

Rabbit polyclonal AK5 antibody raised against the N terminal of AK5

Synonyms Polyclonal AK5 antibody, Anti-AK5 antibody, Adenylate Kinase 5 antibody, AK6 antibody, MGC33326 antibody
Specificity AK5 antibody was raised against the N terminal of AK5
Cross Reactivity Human
Applications WB
Immunogen AK5 antibody was raised using the N terminal of AK5 corresponding to a region with amino acids ESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERY
Assay Information AK5 Blocking Peptide, catalog no. 33R-2721, is also available for use as a blocking control in assays to test for specificity of this AK5 antibody

Images

Western Blot analysis using AK5 antibody (70R-3556)

AK5 antibody (70R-3556) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AK5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the adenylate kinase family, which is involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. This member is related to the UMP/CMP kinase of several species. It is located in the cytosol and expressed exclusively in brain. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using AK5 antibody (70R-3556) | AK5 antibody (70R-3556) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors